PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_5420V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 488aa    MW: 53983.4 Da    PI: 6.887
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_5420V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++lv +++q+G g+W++ +   g+ R++k+c++rw +yl
  Pp3c11_5420V3.2.p 16 KGPWTPDEDQKLVAYIQQHGHGSWRSLPINAGLQRCGKSCRLRWTNYL 63
                       79********************************************97 PP

2Myb_DNA-binding55.71.1e-1769114148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr++ eEd+ +v++++ lG++ W++Ia++++ +Rt++++k++w+++l
  Pp3c11_5420V3.2.p  69 RGRFSHEEDQMIVHLHAILGNR-WSAIASHLP-RRTDNEIKNYWNTHL 114
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-231066IPR009057Homeodomain-like
PROSITE profilePS5129417.4551163IPR017930Myb domain
SuperFamilySSF466894.87E-3015110IPR009057Homeodomain-like
SMARTSM007178.6E-131565IPR001005SANT/Myb domain
PfamPF002492.0E-151663IPR001005SANT/Myb domain
CDDcd001679.49E-111863No hitNo description
PROSITE profilePS5129427.00564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2767118IPR009057Homeodomain-like
SMARTSM007172.1E-1768116IPR001005SANT/Myb domain
PfamPF002497.4E-1669114IPR001005SANT/Myb domain
CDDcd001677.18E-1371114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MTRAPLGDIE KEVLKKGPWT PDEDQKLVAY IQQHGHGSWR SLPINAGLQR CGKSCRLRWT  60
NYLRPDIKRG RFSHEEDQMI VHLHAILGNR WSAIASHLPR RTDNEIKNYW NTHLKKRLMQ  120
MGIDPVTHKS TAAEELVHYS IIPGLRPVVS TNLTHMSQWD SARAEAEARL SRQSSLTSPA  180
SDLAQTSLEH QKSNLSTKND VNNQVASSNF MSSWKAQVTE TLRPNFGVVE LDKPPASPVN  240
LQKFLQEWES SLKAPQPEME GPSIHDSITN IPSLSSGTAS ELVSTQYSPD VSSASYRMPV  300
SSMILPSPAQ ISERLMASRH CDSLLPLPRI DLAGSNIFPA QSPSATESSF SFSGLCKVDN  360
EHQYSPTSIL HGPSGHDSSY SSPCGSSSSA YDSVDILAQS FSLVHNDNHQ HSRATLAMNF  420
SQEPSFWTQQ QVALVDALQP ESYFTHELGV NIAQKPPSHS FNLSVNSMVN QVGVPNNIPI  480
PQFDYLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141185108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX670510.0X67051.1 P.patens mRNA Pp1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751220.11e-125predicted protein, partial
SwissprotP800740.0MYB1_PHYPA; Myb-related protein Pp1 (Fragment)
TrEMBLA9RAV41e-125A9RAV4_PHYPA; Uncharacterized protein (Fragment)
STRINGPP1S389_40V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-72myb domain protein 106